Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Uncharacterized protein encoded by LINC01619 (CL079), Biotinylated

This Recombinant Human Uncharacterized protein encoded by LINC01619 (CL079), Biotinylated spans the amino acid sequence from region 1-115. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Uncharacterized protein encoded by LINC01619 LINC01619 C12orf79

UniProt

G3V211

Expression Region

1-115

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MNVCCSSHPVNEKVWKPSSRKWSSKVWSMDEFDLQTACYWFMTRCQKEAGKFGTHRGKPMCFVRSLLRVQLLPRTFPANSFVISFFPSLIYPLQVYQLHFESSDKQRAMQFVTEG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MICALCL Protein Vector (Rat) (pPB-C-His)
PV282310 500 ng

MICALCL Protein Vector (Rat) (pPB-C-His)

Sign In for Pricing
View Details
Chicken T-Cell Surface Glycoprotein CD3 Delta Chain (CD3D) ELISA Kit
abx258811-01 96 Tests

Chicken T-Cell Surface Glycoprotein CD3 Delta Chain (CD3D) ELISA Kit

Sign In for Pricing
View Details
Chicken T-Cell Surface Glycoprotein CD3 Delta Chain (CD3D) ELISA Kit
abx258811-02 5x 96 Tests

Chicken T-Cell Surface Glycoprotein CD3 Delta Chain (CD3D) ELISA Kit

Sign In for Pricing
View Details
Chicken T-Cell Surface Glycoprotein CD3 Delta Chain (CD3D) ELISA Kit
abx258811-03 10x 96 Tests

Chicken T-Cell Surface Glycoprotein CD3 Delta Chain (CD3D) ELISA Kit

Sign In for Pricing
View Details
NRBF2 CRISPRa sgRNA lentivector (set of three targets)(Human)
32152121 3x 1.0µg DNA

NRBF2 CRISPRa sgRNA lentivector (set of three targets)(Human)

Sign In for Pricing
View Details
TMEM75 siRNA Oligos set (Human)
47090171 3x 5 nmol

TMEM75 siRNA Oligos set (Human)

Sign In for Pricing
View Details