Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Protein FAM72C (FA72C), Biotinylated

This Recombinant Human Protein FAM72C (FA72C), Biotinylated spans the amino acid sequence from region 1-149. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Protein FAM72C FAM72C

UniProt

H0Y354

Expression Region

1-149

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MSTNICSFKDRCVSILCCKFCKQVLSSRGMKAVLLADTEIDLFSTDIPPTNAVDFTGRCYFTKICKCKLKDIACLKCGNIVVYHVIVPCSSCLLSCNNRHFWMFHSQAVYDINRLDSTGVNVLLRGNLPEIEESTDEDVLNISAEECIR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CRBN Polyclonal Antibody, AbBy Fluor™ 680 Conjugated
bs-25408R-BF680 100 µL

CRBN Polyclonal Antibody, AbBy Fluor™ 680 Conjugated

Sign In for Pricing
View Details
Ensartinib 25mg
A19720-25 25 mg

Ensartinib 25mg

Sign In for Pricing
View Details
PC1/3 (PCSK1) (NM_001177875) Human Tagged Lenti ORF Clone
RC230447L4 10 µg

PC1/3 (PCSK1) (NM_001177875) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Tumor Necrosis Factor Receptor superfamily member 1A (TNFRSF1A) Rabbit ELISA Kit
H9435 96 Tests

Tumor Necrosis Factor Receptor superfamily member 1A (TNFRSF1A) Rabbit ELISA Kit

Sign In for Pricing
View Details
Rabbit Polyclonal CDC2L1 Antibody [Janelia Fluor 646]
NBP3-06170JF646 0.1 mL

Rabbit Polyclonal CDC2L1 Antibody [Janelia Fluor 646]

Sign In for Pricing
View Details
IL17C (NM_013278) Human Recombinant Protein
PROTQ9P0M4 20 µg

IL17C (NM_013278) Human Recombinant Protein

Sign In for Pricing
View Details