Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Small leucine-rich protein 1 (SMLR1), partial, Biotinylated

This Recombinant Human Small leucine-rich protein 1 (SMLR1), partial, Biotinylated spans the amino acid sequence from region 74-107. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Small leucine-rich protein 1 SMLR1

UniProt

H3BR10

Expression Region

74-107

Origin

Homo sapiens (Human)

Field of Research

Pharmacology & Drug Discovery

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

RIKLIEVNEELSQNCDRQHNPKDGSSLYQRMKWT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GNAI3 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)
22299066 1.0 µg DNA

GNAI3 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
His-Tag Mouse Monoclonal Antibody
MBS8503244-01 0.1 mg

His-Tag Mouse Monoclonal Antibody

Sign In for Pricing
View Details
His-Tag Mouse Monoclonal Antibody
MBS8503244-02 0.1 mL (AF635)

His-Tag Mouse Monoclonal Antibody

Sign In for Pricing
View Details
His-Tag Mouse Monoclonal Antibody
MBS8503244-03 0.1 mL (AF610)

His-Tag Mouse Monoclonal Antibody

Sign In for Pricing
View Details
His-Tag Mouse Monoclonal Antibody
MBS8503244-04 0.1 mL (AF405S)

His-Tag Mouse Monoclonal Antibody

Sign In for Pricing
View Details
His-Tag Mouse Monoclonal Antibody
MBS8503244-05 0.1 mL (AF405L)

His-Tag Mouse Monoclonal Antibody

Sign In for Pricing
View Details