Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Transmembrane protein 178B (T178B), partial, Biotinylated

This Recombinant Human Transmembrane protein 178B (T178B), partial, Biotinylated spans the amino acid sequence from region 24-171. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Transmembrane protein 178B TMEM178B

UniProt

H3BS89

Expression Region

24-171

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

VAICSDHWYETDARKHRDRCKAFNTRRVDPGFIYNNNNNLPLRASRSRLDRWEGKLLRARNRRQLFAMSPADECSRQYNSTNMGLWRKCHRQGFDPEIAALIRKGEIERCTYIKYHYSSATIPRNLTFNITKTIRQDEWHALHLRRMT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

VAMP4, ID (VAMP4, Vesicle-associated membrane protein 4) (FITC)
MBS6362194-01 0.2 mL

VAMP4, ID (VAMP4, Vesicle-associated membrane protein 4) (FITC)

Sign In for Pricing
View Details
VAMP4, ID (VAMP4, Vesicle-associated membrane protein 4) (FITC)
MBS6362194-02 5x 0.2 mL

VAMP4, ID (VAMP4, Vesicle-associated membrane protein 4) (FITC)

Sign In for Pricing
View Details
Microcentrifuge TT-14500 PRO, 14,500rpm, AC100V
TT-14500 PRO-100V 1 Unit

Microcentrifuge TT-14500 PRO, 14,500rpm, AC100V

Sign In for Pricing
View Details
SDCCAG8, NT (SDCCAG8, CCCAP, Serologically defined colon cancer antigen 8, Antigen NY-CO-8, Centrosomal colon cancer autoantigen protein) (Azide free) (HRP) discontinued
041490-HRP 200 µL

SDCCAG8, NT (SDCCAG8, CCCAP, Serologically defined colon cancer antigen 8, Antigen NY-CO-8, Centrosomal colon cancer autoantigen protein) (Azide free) (HRP) discontinued

Sign In for Pricing
View Details
ELISA Kit For Fibrillin-2
E8805m 96 Tests

ELISA Kit For Fibrillin-2

Sign In for Pricing
View Details
Recombinant Human IL36RN Protein, N-His
orb2834409-01 20 µg

Recombinant Human IL36RN Protein, N-His

Sign In for Pricing
View Details