Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Transmembrane protein 178B (T178B), partial, Biotinylated

This Recombinant Human Transmembrane protein 178B (T178B), partial, Biotinylated spans the amino acid sequence from region 24-171. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Transmembrane protein 178B TMEM178B

UniProt

H3BS89

Expression Region

24-171

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

VAICSDHWYETDARKHRDRCKAFNTRRVDPGFIYNNNNNLPLRASRSRLDRWEGKLLRARNRRQLFAMSPADECSRQYNSTNMGLWRKCHRQGFDPEIAALIRKGEIERCTYIKYHYSSATIPRNLTFNITKTIRQDEWHALHLRRMT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MAP3K6 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
28033111 3x 1.0 µg

MAP3K6 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
4930407I10Rik sgRNA CRISPR Lentivector set (Mouse)
K3129801 3x 1.0 µg

4930407I10Rik sgRNA CRISPR Lentivector set (Mouse)

Sign In for Pricing
View Details
WBP2 Antibody
A63636-100UG 100 µg

WBP2 Antibody

Sign In for Pricing
View Details
Ctsq AAV siRNA Pooled Vector
17118164 1.0 µg

Ctsq AAV siRNA Pooled Vector

Sign In for Pricing
View Details
Recombinant Streptococcus pyogenes EndoS Protein, N-GST
orb2830983-01 20 µg

Recombinant Streptococcus pyogenes EndoS Protein, N-GST

Sign In for Pricing
View Details
Recombinant Streptococcus pyogenes EndoS Protein, N-GST
orb2830983-02 50 µg

Recombinant Streptococcus pyogenes EndoS Protein, N-GST

Sign In for Pricing
View Details