Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Testis-expressed protein 46 (TEX46), partial, Biotinylated

This Recombinant Human Testis-expressed protein 46 (TEX46), partial, Biotinylated spans the amino acid sequence from region 37-121. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Testis-expressed protein 46 TEX46 C1orf234

UniProt

H3BTG2

Expression Region

37-121

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

LSNWLVKYEHKLTLPEPQQDEILQRLLFSEMKMKVLENQMFIIWNKMNHHGRSSRHRNFPMKKHRMRRHESICPTLSDCTSSSPS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rumenic Acid (~80%)
TRC-R701590-50MG 50 mg

Rumenic Acid (~80%)

Sign In for Pricing
View Details
HDAC10 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI8G5]
TA500751AM 100 µL

HDAC10 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI8G5]

Sign In for Pricing
View Details
7-(4-Chlorobutoxy)quinolin-2(1H)-one
TRC-C381343-2.5G 2.5 g

7-(4-Chlorobutoxy)quinolin-2(1H)-one

Sign In for Pricing
View Details
Twist (TWIST1) Human Gene Knockout Kit (CRISPR)
KN202920BN 1 Kit

Twist (TWIST1) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
MTRF1 Mouse Monoclonal Antibody [Clone ID: OTI5D5]
CF813067 100 µg

MTRF1 Mouse Monoclonal Antibody [Clone ID: OTI5D5]

Sign In for Pricing
View Details
Strontium Chloride Hexahydrate
TRC-S687650-50G 50 g

Strontium Chloride Hexahydrate

Sign In for Pricing
View Details