Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Testis-expressed protein 46 (TEX46), partial, Biotinylated

This Recombinant Human Testis-expressed protein 46 (TEX46), partial, Biotinylated spans the amino acid sequence from region 37-121. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Testis-expressed protein 46 TEX46 C1orf234

UniProt

H3BTG2

Expression Region

37-121

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

LSNWLVKYEHKLTLPEPQQDEILQRLLFSEMKMKVLENQMFIIWNKMNHHGRSSRHRNFPMKKHRMRRHESICPTLSDCTSSSPS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD46 (122.2), CF740 conjugate, 0.1mg/mL
BNC740175-500 1x 500 µL

CD46 (122.2), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Fetuin A Recombinant Rabbit Monoclonal Antibody [JE54-96]
HA721436 100 µL

Fetuin A Recombinant Rabbit Monoclonal Antibody [JE54-96]

Sign In for Pricing
View Details
TissueScan, Lymphoma cDNA Array I
LYRT501 10 Panels

TissueScan, Lymphoma cDNA Array I

Sign In for Pricing
View Details
CD44 Standard (156-3C11), CF740 conjugate, 0.1mg/mL
BNC740460-100 1x 100 µL

CD44 Standard (156-3C11), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MAGEA5 Antibody
8G875-AAT 50 µg

MAGEA5 Antibody

Sign In for Pricing
View Details
(3Alpha,5Beta,11Beta)-Pregnane-3,11,17,20,21-pentol 21-Acetate
TRC-P705235-50MG 50 mg

(3Alpha,5Beta,11Beta)-Pregnane-3,11,17,20,21-pentol 21-Acetate

Sign In for Pricing
View Details