Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Coiled-coil domain-containing protein 179 (CC179), Biotinylated

This Recombinant Human Coiled-coil domain-containing protein 179 (CC179), Biotinylated spans the amino acid sequence from region 1-68. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Coiled-coil domain-containing protein 179 CCDC179

UniProt

H3BU77

Expression Region

1-68

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MCLYCWDIEPSQVNPEGPRQHHPSEVTERQLANKRIQNMQHLKKEKRRLNKRFSRPSPIPEPGLLWSS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SCN5A, NT (SCN5A, Sodium channel protein type 5 subunit alpha, HH1, Sodium channel protein cardiac muscle subunit alpha, Sodium channel protein type V subunit alpha, Voltage-gated sodium channel subunit alpha Nav1.5) (MaxLight 490) discontinued
041466-ML490 100 µL

SCN5A, NT (SCN5A, Sodium channel protein type 5 subunit alpha, HH1, Sodium channel protein cardiac muscle subunit alpha, Sodium channel protein type V subunit alpha, Voltage-gated sodium channel subunit alpha Nav1.5) (MaxLight 490) discontinued

Sign In for Pricing
View Details
TSHZ1 Polyclonal Antibody
ABP53438-01 30 µL

TSHZ1 Polyclonal Antibody

Sign In for Pricing
View Details
TSHZ1 Polyclonal Antibody
ABP53438-02 100 µL

TSHZ1 Polyclonal Antibody

Sign In for Pricing
View Details
TSHZ1 Polyclonal Antibody
ABP53438-03 200 µL

TSHZ1 Polyclonal Antibody

Sign In for Pricing
View Details
Biotin-Linked Anti-Vascular Endothelial Growth Factor Receptor 1 (VEGFR1)
FY-AB42664-01 1 mL

Biotin-Linked Anti-Vascular Endothelial Growth Factor Receptor 1 (VEGFR1)

Sign In for Pricing
View Details
Biotin-Linked Anti-Vascular Endothelial Growth Factor Receptor 1 (VEGFR1)
FY-AB42664-02 100 µL

Biotin-Linked Anti-Vascular Endothelial Growth Factor Receptor 1 (VEGFR1)

Sign In for Pricing
View Details