Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Claudin-34 (CLD34), partial, Biotinylated

This Recombinant Human Claudin-34 (CLD34), partial, Biotinylated spans the amino acid sequence from region 33-80. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Claudin-34 CLDN34

UniProt

H7C241

Expression Region

33-80

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EWRIWYMKDTSLYPPGIACVGIFRVCIYRRRTNSTTTKFCYRYSYQDT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

N6amt1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 1)
K6205306 1.0 µg DNA

N6amt1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 1)

Sign In for Pricing
View Details
BST2, His, Cynomolgus
Z04752-500 500 µg

BST2, His, Cynomolgus

Sign In for Pricing
View Details
Anti-RRP8 Antibody Picoband® Fluoro594 Conjugated
A09950-2-Fluoro594 100 µg/Vial

Anti-RRP8 Antibody Picoband® Fluoro594 Conjugated

Sign In for Pricing
View Details
NAT-8L siRNA (h)
sc-89038 10 µM

NAT-8L siRNA (h)

Sign In for Pricing
View Details
KDM1/LSD1 Polyclonal Antibody, AbBy Fluor™ 555 Conjugated
bs-10166R-BF555 100 µL

KDM1/LSD1 Polyclonal Antibody, AbBy Fluor™ 555 Conjugated

Sign In for Pricing
View Details
PLGF (PGF) Human siRNA Oligo Duplex (Locus ID 5228)
SR303478 1 Kit

PLGF (PGF) Human siRNA Oligo Duplex (Locus ID 5228)

Sign In for Pricing
View Details