Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Claudin-34 (CLD34), partial, Biotinylated

This Recombinant Human Claudin-34 (CLD34), partial, Biotinylated spans the amino acid sequence from region 33-80. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Claudin-34 CLDN34

UniProt

H7C241

Expression Region

33-80

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EWRIWYMKDTSLYPPGIACVGIFRVCIYRRRTNSTTTKFCYRYSYQDT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

VU 0357121
S2795-10mM/1mL 10 mM/1mL

VU 0357121

Sign In for Pricing
View Details
Human Ephrin A4 ELISA Kit
MBS077698-01 48 Well

Human Ephrin A4 ELISA Kit

Sign In for Pricing
View Details
Human Ephrin A4 ELISA Kit
MBS077698-02 96 Well

Human Ephrin A4 ELISA Kit

Sign In for Pricing
View Details
Human Ephrin A4 ELISA Kit
MBS077698-03 5x 96 Well

Human Ephrin A4 ELISA Kit

Sign In for Pricing
View Details
Human Ephrin A4 ELISA Kit
MBS077698-04 10x 96 Well

Human Ephrin A4 ELISA Kit

Sign In for Pricing
View Details
Pulocimab Antibody
orb1980314 5 mg

Pulocimab Antibody

Sign In for Pricing
View Details