Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Claudin-34 (CLD34), partial, Biotinylated

This Recombinant Human Claudin-34 (CLD34), partial, Biotinylated spans the amino acid sequence from region 33-80. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Claudin-34 CLDN34

UniProt

H7C241

Expression Region

33-80

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EWRIWYMKDTSLYPPGIACVGIFRVCIYRRRTNSTTTKFCYRYSYQDT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

UEVLD sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
49089111 3x 1.0 µg

UEVLD sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
p53 (TP53) Rabbit Polyclonal Antibody
TA326092 100 µL

p53 (TP53) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
MMEL1 Blocking Peptide
33R-2809 100 ug

MMEL1 Blocking Peptide

Sign In for Pricing
View Details
PDE4DIP Protein Vector (Mouse) (pPM-C-HA)
PV214620 500 ng

PDE4DIP Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
Rat EPH Receptor A6 (EPHA6) ELISA Kit
abx522148 96 Tests

Rat EPH Receptor A6 (EPHA6) ELISA Kit

Sign In for Pricing
View Details
RCOR1 Antibody - N-terminal region : HRP (ARP39178_T100-HRP)
ARP39178_T100-HRP 100 µL

RCOR1 Antibody - N-terminal region : HRP (ARP39178_T100-HRP)

Sign In for Pricing
View Details