Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Claudin-34 (CLD34), partial, Biotinylated

This Recombinant Human Claudin-34 (CLD34), partial, Biotinylated spans the amino acid sequence from region 33-80. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Claudin-34 CLDN34

UniProt

H7C241

Expression Region

33-80

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EWRIWYMKDTSLYPPGIACVGIFRVCIYRRRTNSTTTKFCYRYSYQDT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GD3 Synthase (B-11) Alexa Fluor® 488
sc-390123 AF488 200 µg/mL

GD3 Synthase (B-11) Alexa Fluor® 488

Sign In for Pricing
View Details
SUZ12 sgRNA CRISPR Lentivector (Human) (Target 1)
K2317402 1.0 µg DNA

SUZ12 sgRNA CRISPR Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
O-Des- (2,2-methylbutyryl) Spirodiclofen
CS-T-88665 1 Each

O-Des- (2,2-methylbutyryl) Spirodiclofen

Sign In for Pricing
View Details
Human CD8 alpha Alexa Fluor 700 MAb (Clone 37006)
FAB1509N-025 25 Tests

Human CD8 alpha Alexa Fluor 700 MAb (Clone 37006)

Sign In for Pricing
View Details
Actr2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 3)
K7373608 1.0 µg DNA

Actr2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 3)

Sign In for Pricing
View Details
Human SETMAR Protein Lysate 20ug
IHUSETMARPLLY20UG 20 µg

Human SETMAR Protein Lysate 20ug

Sign In for Pricing
View Details