Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Uncharacterized protein ZNF561-AS1 (CS082), Biotinylated

This Recombinant Human Uncharacterized protein ZNF561-AS1 (CS082), Biotinylated spans the amino acid sequence from region 1-104. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Uncharacterized protein ZNF561-AS1; ZNF561 antisense RNA 1; ZNF561 antisense gene protein 1; ZNF561-AS1 C19orf82

UniProt

K7EIQ3

Expression Region

1-104

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MGRIPGGCSSKAFIGRAQWLTPVIPALWEAKGLTLLSRLECSDVIMDHCSPQLTGLRMKGFLAQTPPLEFPVHQYQPGDHVLIKSWKRESLNQLRRTSSGTLDE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pigment Orange 13 (Technical Grade)
TRC-P437813-5G 5 g

Pigment Orange 13 (Technical Grade)

Sign In for Pricing
View Details
Tom1 Mouse Gene Knockout Kit (CRISPR)
KN518042 1 Kit

Tom1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
MMP3 (Marker of Metastasis and Rheumatoid Arthritis) (MMP3/2655), CF640R conjugate, 0.1mg/mL
BNC402655-500 1x 500 µL

MMP3 (Marker of Metastasis and Rheumatoid Arthritis) (MMP3/2655), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Helicobacter pylori (HP/1335), CF647 conjugate, 0.1mg/mL
BNC471335-100 1x 100 µL

Helicobacter pylori (HP/1335), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
IGF1 Mouse Monoclonal Antibody [Clone ID: AT6F8]
AM50335PU-S 50 µL

IGF1 Mouse Monoclonal Antibody [Clone ID: AT6F8]

Sign In for Pricing
View Details
PNPLA4 (NM_001172672) Human Over-expression Lysate
LY432621 100 µg

PNPLA4 (NM_001172672) Human Over-expression Lysate

Sign In for Pricing
View Details