Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Uncharacterized protein ZNF561-AS1 (CS082), Biotinylated

This Recombinant Human Uncharacterized protein ZNF561-AS1 (CS082), Biotinylated spans the amino acid sequence from region 1-104. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Uncharacterized protein ZNF561-AS1; ZNF561 antisense RNA 1; ZNF561 antisense gene protein 1; ZNF561-AS1 C19orf82

UniProt

K7EIQ3

Expression Region

1-104

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MGRIPGGCSSKAFIGRAQWLTPVIPALWEAKGLTLLSRLECSDVIMDHCSPQLTGLRMKGFLAQTPPLEFPVHQYQPGDHVLIKSWKRESLNQLRRTSSGTLDE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LRP5L (NM_182492) Human Recombinant Protein
TP311399 20 µg

LRP5L (NM_182492) Human Recombinant Protein

Sign In for Pricing
View Details
TNFAIP8L1 (NM_152362) Human Tagged ORF Clone
RC203912 10 µg

TNFAIP8L1 (NM_152362) Human Tagged ORF Clone

Sign In for Pricing
View Details
Magic™ Antibody Discovery - Human Osteoprotegerin / TNFRSF11B (22-401) Membrane Protein, PaRoom Temperatureial, -His tag
MP0729F Each

Magic™ Antibody Discovery - Human Osteoprotegerin / TNFRSF11B (22-401) Membrane Protein, PaRoom Temperatureial, -His tag

Sign In for Pricing
View Details
TRAF2 Polyclonal Antibody, PE-Cy5.5 Conjugated
bs-1213R-PE-Cy5.5 100 µL

TRAF2 Polyclonal Antibody, PE-Cy5.5 Conjugated

Sign In for Pricing
View Details
Transglutaminase 2 Rabbit pAb
orb1565593-01 20 ul

Transglutaminase 2 Rabbit pAb

Sign In for Pricing
View Details
Transglutaminase 2 Rabbit pAb
orb1565593-02 50 µL

Transglutaminase 2 Rabbit pAb

Sign In for Pricing
View Details