Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Protein RD3-like (RD3L), Biotinylated

This Recombinant Human Protein RD3-like (RD3L), Biotinylated spans the amino acid sequence from region 1-198. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Protein RD3-like; Retinal degeneration protein 3-like; RD3L

UniProt

P0DJH9

Expression Region

1-198

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MPLFGWMKWPKNDSYKPTHYPGSDIVTKTLLRELKWHLKERERLIQEIENEQKVKKTGVDYNWLRNYQNPHTTIPVTEQRQLEVLCSQVQPCQTGTILSRFREVLAENDVLPWEIVYIFKQVLKDFLSSSDRGSEQEDLEDSGSMDCSAPSVIQGDSSKRADKDEIPTISSYVDKNTKDRFPVFSHRIWNLPYYHPSS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

D-Alanine 99% For Biochemistry
8600025 25 mg

D-Alanine 99% For Biochemistry

Sign In for Pricing
View Details
Anti-TSLP Antibody (Schering patent anti-TSLP)
F1873-5 5 mg

Anti-TSLP Antibody (Schering patent anti-TSLP)

Sign In for Pricing
View Details
SVOPL siRNA Oligos set (Human)
45928171 3x 5 nmol

SVOPL siRNA Oligos set (Human)

Sign In for Pricing
View Details
ADAM17 Antibody
orb622173-01 50 μL

ADAM17 Antibody

Sign In for Pricing
View Details
ADAM17 Antibody
orb622173-02 100 µL

ADAM17 Antibody

Sign In for Pricing
View Details
Anti-NAT10 Antibody (R2R28)
RHN75601 100 μg

Anti-NAT10 Antibody (R2R28)

Sign In for Pricing
View Details