Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Small integral membrane protein 17 (SIM17), partial, Biotinylated

This Recombinant Human Small integral membrane protein 17 (SIM17), partial, Biotinylated spans the amino acid sequence from region 1-95. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Small integral membrane protein 17 SMIM17

UniProt

P0DL12

Expression Region

1-95

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MQSLRPEQTRGLLEPERTKTLLPRESRAWEKPPHPACTKDWEAVEVGASSHDSDEKDLSSQETGLSQEWSSVEEDDESEGSQGFVEWSKAPQQTT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SOD1 Polyclonal Antibody
E-AB-40047-01 25 µL

SOD1 Polyclonal Antibody

Sign In for Pricing
View Details
SOD1 Polyclonal Antibody
E-AB-40047-02 100 µL

SOD1 Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Human IA2/PTPRN Protein (aa 687-979, His Tag)
PKSH032556-01 10 µg

Recombinant Human IA2/PTPRN Protein (aa 687-979, His Tag)

Sign In for Pricing
View Details
Recombinant Human IA2/PTPRN Protein (aa 687-979, His Tag)
PKSH032556-02 50 µg

Recombinant Human IA2/PTPRN Protein (aa 687-979, His Tag)

Sign In for Pricing
View Details
GPR82 Antibody
8G354-AAT 50 µg

GPR82 Antibody

Sign In for Pricing
View Details
MAN2B1 (NM_000528) Human Over-expression Lysate
LC424654 20 µg

MAN2B1 (NM_000528) Human Over-expression Lysate

Sign In for Pricing
View Details