Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Small integral membrane protein 17 (SIM17), partial, Biotinylated

This Recombinant Human Small integral membrane protein 17 (SIM17), partial, Biotinylated spans the amino acid sequence from region 1-95. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Small integral membrane protein 17 SMIM17

UniProt

P0DL12

Expression Region

1-95

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MQSLRPEQTRGLLEPERTKTLLPRESRAWEKPPHPACTKDWEAVEVGASSHDSDEKDLSSQETGLSQEWSSVEEDDESEGSQGFVEWSKAPQQTT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Olfr1009 (NM_146572) Mouse Tagged Lenti ORF Clone
MR218177L3 10 µg

Olfr1009 (NM_146572) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Mtfmt Mouse siRNA Oligo Duplex (Locus ID 69606)
SR412984 1 Kit

Mtfmt Mouse siRNA Oligo Duplex (Locus ID 69606)

Sign In for Pricing
View Details
Aurora C (AURKC) Mouse Monoclonal Antibody [Clone ID: OTI10A7]
TA500554S 30 µL

Aurora C (AURKC) Mouse Monoclonal Antibody [Clone ID: OTI10A7]

Sign In for Pricing
View Details
C20orf30 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
14303061 1.0 µg DNA

C20orf30 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Complement C5 beta chain Rabbit pAb, BF700 conjugated
orb2872793 100 µL

Complement C5 beta chain Rabbit pAb, BF700 conjugated

Sign In for Pricing
View Details
Recombinant Human AKR1A1 Protein, Untagged, E.coli-1mg
QP10994-1mg 1mg

Recombinant Human AKR1A1 Protein, Untagged, E.coli-1mg

Sign In for Pricing
View Details