Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Putative transmembrane protein INAFM2 (INAM2), partial, Biotinylated

This Recombinant Human Putative transmembrane protein INAFM2 (INAM2), partial, Biotinylated spans the amino acid sequence from region 57-153. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Putative transmembrane protein INAFM2; InaF-motif-containing protein 2; Osteogenesis up-regulated transcript 1; INAFM2 LINC00984 OGU1

UniProt

P0DMQ5

Expression Region

57-153

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

YSLIWQPVGAGTSGGAAGPPPGGSNATGPSGTSGAAAAGPNTTGSSRREAPRDVPPLQAARPAPPEPPADSPPAGPLERPRGPDEDEEETAAAPGSR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

N-(4-Aminobenzoyl)-D-glutamic Acid
TRC-A593820-25MG 25 mg

N-(4-Aminobenzoyl)-D-glutamic Acid

Sign In for Pricing
View Details
OPA3 Knockout MES-OV Polyclonal Cells
ARG6448 1 Million

OPA3 Knockout MES-OV Polyclonal Cells

Sign In for Pricing
View Details
Recombinant Human Adaptor Related Protein Complex 2 Sigma 1 (AP2s1)
RPU58249-01 50 µg

Recombinant Human Adaptor Related Protein Complex 2 Sigma 1 (AP2s1)

Sign In for Pricing
View Details
Recombinant Human Adaptor Related Protein Complex 2 Sigma 1 (AP2s1)
RPU58249-02 100 µg

Recombinant Human Adaptor Related Protein Complex 2 Sigma 1 (AP2s1)

Sign In for Pricing
View Details
Recombinant Human Adaptor Related Protein Complex 2 Sigma 1 (AP2s1)
RPU58249-03 1 mg

Recombinant Human Adaptor Related Protein Complex 2 Sigma 1 (AP2s1)

Sign In for Pricing
View Details
SPINK5 Protein Lysate (Mouse) with C-HA Tag
45335034 100 µg

SPINK5 Protein Lysate (Mouse) with C-HA Tag

Sign In for Pricing
View Details