Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Putative protein T-ENOL (ENOL), Biotinylated

This Recombinant Human Putative protein T-ENOL (ENOL), Biotinylated spans the amino acid sequence from region 1-83. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Putative protein T-ENOL; CDIP transferase opposite strand, pseudogene; CDIPT antisense RNA 1; CDIPTOSP CDIPT-AS1 T-ENOL

UniProt

P0DO92

Expression Region

1-83

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MASTPMGNEGEKKSSWPSQAAPSLRGGPASLSRSEEYLSQISAELMEEALCTACCHLNPVPIKKKQSQDQATQISKRAFFTKT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue FFPE Sections, Lung
CS800081 5x 5 µm

Tissue FFPE Sections, Lung

Sign In for Pricing
View Details
HERC5 Antibody
KC-2365-01 50 μL

HERC5 Antibody

Sign In for Pricing
View Details
HERC5 Antibody
KC-2365-02 100 µL

HERC5 Antibody

Sign In for Pricing
View Details
HERC5 Antibody
KC-2365-03 1 mL

HERC5 Antibody

Sign In for Pricing
View Details
UFD1 Human Gene Knockout Kit (CRISPR)
KN402989 1 Kit

UFD1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
SETD4 (NM_001007261) Human Tagged ORF Clone
RG237166 10 µg

SETD4 (NM_001007261) Human Tagged ORF Clone

Sign In for Pricing
View Details