Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Putative protein T-ENOL (ENOL), Biotinylated

This Recombinant Human Putative protein T-ENOL (ENOL), Biotinylated spans the amino acid sequence from region 1-83. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Putative protein T-ENOL; CDIP transferase opposite strand, pseudogene; CDIPT antisense RNA 1; CDIPTOSP CDIPT-AS1 T-ENOL

UniProt

P0DO92

Expression Region

1-83

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MASTPMGNEGEKKSSWPSQAAPSLRGGPASLSRSEEYLSQISAELMEEALCTACCHLNPVPIKKKQSQDQATQISKRAFFTKT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Adrm1 3'UTR Luciferase Stable Cell Line
TU200354 1.0 mL

Adrm1 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Rat Monoclonal CD25/IL-2 R alpha Antibody (280414) [Alexa Fluor 700]
MAB24383AF700 100 µL

Rat Monoclonal CD25/IL-2 R alpha Antibody (280414) [Alexa Fluor 700]

Sign In for Pricing
View Details
ACSM4 (NM_001080454) Human Over-expression Lysate
LS341392-100ug 100 µg

ACSM4 (NM_001080454) Human Over-expression Lysate

Sign In for Pricing
View Details
Pan2 ORF Vector (Mouse) (pORF)
ORF053341 1.0 µg DNA

Pan2 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
Bovine Alpha-1, 6-Mannosylglycoprotein 6-Beta-N-Acetylglucosaminyltransferase A (MGAT5) ELISA Kit
MBS9932722-01 48 Well

Bovine Alpha-1, 6-Mannosylglycoprotein 6-Beta-N-Acetylglucosaminyltransferase A (MGAT5) ELISA Kit

Sign In for Pricing
View Details
Bovine Alpha-1, 6-Mannosylglycoprotein 6-Beta-N-Acetylglucosaminyltransferase A (MGAT5) ELISA Kit
MBS9932722-02 96 Well

Bovine Alpha-1, 6-Mannosylglycoprotein 6-Beta-N-Acetylglucosaminyltransferase A (MGAT5) ELISA Kit

Sign In for Pricing
View Details