Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Transmembrane protein 225B (T225B), partial, Biotinylated

This Recombinant Human Transmembrane protein 225B (T225B), partial, Biotinylated spans the amino acid sequence from region 168-221. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Transmembrane protein 225B TMEM225B

UniProt

P0DP42

Expression Region

168-221

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

CLIQEMVCPCWHLLSTSQSMEEDHGSLYLDNLESLGGEPSSVQKETQVTAETVI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GFM1 CRISPR Knock Out 293T Cell Line (Human)
21453141 1x 10^6 Cells / 1.0 mL

GFM1 CRISPR Knock Out 293T Cell Line (Human)

Sign In for Pricing
View Details
Tmem33 Peptide - middle region
MBS3233516-01 0.1 mg

Tmem33 Peptide - middle region

Sign In for Pricing
View Details
Tmem33 Peptide - middle region
MBS3233516-02 5x 0.1 mg

Tmem33 Peptide - middle region

Sign In for Pricing
View Details
Armenian Hamster Anti-TCR beta Recombinant Antibody (AG171)
V2LY-0524-LY163 Each

Armenian Hamster Anti-TCR beta Recombinant Antibody (AG171)

Sign In for Pricing
View Details
Lentiviral mouse Txnrd3 shRNA (UAS) - Lentiviral mouse Txnrd3 shRNA (UAS, GFP) (100)
GTR15125961 1 Vial

Lentiviral mouse Txnrd3 shRNA (UAS) - Lentiviral mouse Txnrd3 shRNA (UAS, GFP) (100)

Sign In for Pricing
View Details
RNF89 (TRIM6) (NM_001003818) Human Tagged ORF Clone
RC207951 10 µg

RNF89 (TRIM6) (NM_001003818) Human Tagged ORF Clone

Sign In for Pricing
View Details