Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Transmembrane protein 225B (T225B), partial, Biotinylated

This Recombinant Human Transmembrane protein 225B (T225B), partial, Biotinylated spans the amino acid sequence from region 168-221. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Transmembrane protein 225B TMEM225B

UniProt

P0DP42

Expression Region

168-221

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

CLIQEMVCPCWHLLSTSQSMEEDHGSLYLDNLESLGGEPSSVQKETQVTAETVI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RSL1D1 Protein Vector (Rat) (pPB-C-His)
PV302678 500 ng

RSL1D1 Protein Vector (Rat) (pPB-C-His)

Sign In for Pricing
View Details
Rabbit Monoclonal Serum Amyloid A4 Antibody (126) [Alexa Fluor 594]
NBP2-89888AF594 0.1 mL

Rabbit Monoclonal Serum Amyloid A4 Antibody (126) [Alexa Fluor 594]

Sign In for Pricing
View Details
Symplekin (G-6) Alexa Fluor® 647
sc-398897 AF647 200 µg/mL

Symplekin (G-6) Alexa Fluor® 647

Sign In for Pricing
View Details
CXorf41 3'UTR Lenti-reporter-Luc Vector
17202081 1.0 µg

CXorf41 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
Klhl8 Rat shRNA Lentiviral Particle (Locus ID 289457)
TL704589V 500 µL Each

Klhl8 Rat shRNA Lentiviral Particle (Locus ID 289457)

Sign In for Pricing
View Details
Rat Acyl-coenzyme A synthetase ACSM3, mitochondrial (ACSM3) ELISA Kit
MBS7214113-01 48 Well

Rat Acyl-coenzyme A synthetase ACSM3, mitochondrial (ACSM3) ELISA Kit

Sign In for Pricing
View Details