Recombinant Human Putative uncharacterized protein MED14OS (M14OS), Biotinylated
This Recombinant Human Putative uncharacterized protein MED14OS (M14OS), Biotinylated spans the amino acid sequence from region 1-135. Purity: Greater than 85% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
Putative uncharacterized protein MED14OS; MED14 antisense gene protein 1; MED14 opposite strand protein; MED14OS MED14-AS1
UniProt
P0DP75
Expression Region
1-135
Origin
Homo sapiens (Human)
Endotoxin
Not test
Purity
Greater than 85% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Storage Conditions
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
AA Sequence
MRSSSLPGARSPRRNGSGQSRHRLPPGRLRTGSRAPTAEARPHVARSPPTPGTGARGGGRRGWGGSRAAPQRGSCASANAQKQLRQTAATYMLTARGGSRSAERKGDLQRTFRQVGQTMPMVPPLDFTMNAASVE
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MT10F4-JAC 10x 96 Well Plates
Jacalin Coated - 96 well plates - 8 Well Strips on 12 x 8 frame - Clear PS
Sign In for Pricing
View Details 
LY421695 100 µg
SERPINB7 (NM_001040147) Human Over-expression Lysate
Sign In for Pricing
View Details 
TRC-P158850-25MG 25 mg
rac-1-Palmitoyl-2-linolenoyl-3-chloropropanediol
Sign In for Pricing
View Details