Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Putative uncharacterized protein SNHG28 (SNH28), Biotinylated

This Recombinant Human Putative uncharacterized protein SNHG28 (SNH28), Biotinylated spans the amino acid sequence from region 1-235. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Putative uncharacterized protein SNHG28; Small nucleolar RNA host gene 2; VSIG8 overlapping transcript protein; VSIG8-OT1; SNHG28 C1orf204

UniProt

P0DPA3

Expression Region

1-235

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MGMLAPGPLQGRRPRKGHKGQEDAVAPGCKASGRGSRVTHLLGYPTQNVSRSLRRKYAPPPCGGPEDVALAPCTAAAACEAGPSPVYVKVKSAEPADCAEGPVQCKNGLLVSSPHCEEPCAHSCAHPGLPPHLVHKLPLSYLQTQDTDAASRRINAPLAAGWSWLRLWLVTLASGVDFPQVSAWMRALPSPDCPGLRTTGEQMQKLLLKENKVKTRKSKRRSGEGSHLTTSILEQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Actin, sarcomeric muscle (ABT-SCA) Mouse mAb
E2252901 100 µL

Actin, sarcomeric muscle (ABT-SCA) Mouse mAb

Sign In for Pricing
View Details
Rat Cytochrome P450 3A ELISA Kit
MBS3809674-01 48 Well

Rat Cytochrome P450 3A ELISA Kit

Sign In for Pricing
View Details
Rat Cytochrome P450 3A ELISA Kit
MBS3809674-02 96 Well

Rat Cytochrome P450 3A ELISA Kit

Sign In for Pricing
View Details
Rat Cytochrome P450 3A ELISA Kit
MBS3809674-03 5x 96 Well

Rat Cytochrome P450 3A ELISA Kit

Sign In for Pricing
View Details
Rat Cytochrome P450 3A ELISA Kit
MBS3809674-04 10x 96 Well

Rat Cytochrome P450 3A ELISA Kit

Sign In for Pricing
View Details
SEPTIN9 Rabbit Polyclonal Antibody
E10G00189 100 µL

SEPTIN9 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details