Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Centromere protein V-like protein 2 (CENL2), Biotinylated

This Recombinant Human Centromere protein V-like protein 2 (CENL2), Biotinylated spans the amino acid sequence from region 1-272. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Centromere protein V-like protein 2; Centromere protein V pseudogene 2; CENPVL2 CENPVP2

UniProt

P0DPI3

Expression Region

1-272

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MGRVRNRATAQRRRRKRPGDPPAACAAIAVTGASRAQCPRVQVGVGSHAAAKRWLGRWRRKRRWRRVRKAGPRDLLPSAPTPDPPGPAPSPKDLDLGAQRERWETFRKLRGLSCEGAAKVLLDTFEYPGLVHHTGGCHCGAVRFAVWAPADLRVVDCSCRLCRKKQHRHFLVPASRFTLLQGAESIVTYRSNTHPALHSFCSRCGVQSFHAAVSDPRVYGVAPHCLDEGTVRSVVIEEVGGGDPGEEAAEEHKAIHKTSSQSAPACPREQEQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue Total RNA, Colon: left
CR561695 5 µg

Tissue Total RNA, Colon: left

Sign In for Pricing
View Details
5-Benzylidenehydantoin
TRC-B016643-2.5G 2.5 g

5-Benzylidenehydantoin

Sign In for Pricing
View Details
Recombinant MEN1 Antibody
RC-4078-01 50 μL

Recombinant MEN1 Antibody

Sign In for Pricing
View Details
Recombinant MEN1 Antibody
RC-4078-02 100 µL

Recombinant MEN1 Antibody

Sign In for Pricing
View Details
Recombinant MEN1 Antibody
RC-4078-03 1 mL

Recombinant MEN1 Antibody

Sign In for Pricing
View Details
Human OR1S2 activation kit by CRISPRa
GA116538 1 Kit

Human OR1S2 activation kit by CRISPRa

Sign In for Pricing
View Details