Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Lymphocyte antigen 6S (LY6S), Biotinylated

This Recombinant Human Lymphocyte antigen 6S (LY6S), Biotinylated spans the amino acid sequence from region 27-105. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Lymphocyte antigen 6S LY6S

UniProt

P0DTL4

Expression Region

27-105

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

LRCYRCLAVLEGASCSVVSCPFLDGVCVSQKVSVFGSKVRGENKLSLLSCQKDVGFPLLKLTSAVVDSQISCCKGDLCN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

P53 (PAb122), CF740 conjugate, 0.1mg/mL
BNC740338-100 1x 100 µL

P53 (PAb122), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD28 (204.12), CF770 conjugate, 0.1mg/mL
BNC700164-500 1x 500 µL

CD28 (204.12), CF770 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ep-CAM / CD326 (Epithelial Marker) (rVU-1D9), CF568 conjugate, 0.1mg/mL
BNC681820-100 1x 100 µL

Ep-CAM / CD326 (Epithelial Marker) (rVU-1D9), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD10 (CB-CALLA), CF594 conjugate, 0.1mg/mL
BNC940146-100 1x 100 µL

CD10 (CB-CALLA), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P63 (Squamous, Basal and Myoepithelial Cell Marker) (TP63/1786), CF488A conjugate, 0.1mg/mL
BNC881786-100 1x 100 µL

P63 (Squamous, Basal and Myoepithelial Cell Marker) (TP63/1786), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD59 / Complement Regulatory Protein / Protectin (MACIF/2867R), CF640R conjugate, 0.1mg/mL
BNC402867-100 1x 100 µL

CD59 / Complement Regulatory Protein / Protectin (MACIF/2867R), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details