Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Lymphocyte antigen 6S (LY6S), Biotinylated

This Recombinant Human Lymphocyte antigen 6S (LY6S), Biotinylated spans the amino acid sequence from region 27-105. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Lymphocyte antigen 6S LY6S

UniProt

P0DTL4

Expression Region

27-105

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

LRCYRCLAVLEGASCSVVSCPFLDGVCVSQKVSVFGSKVRGENKLSLLSCQKDVGFPLLKLTSAVVDSQISCCKGDLCN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FE65 (APBB1) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI3H9]
TA811159BM 100 µL

FE65 (APBB1) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI3H9]

Sign In for Pricing
View Details
DBX2 (NM_001004329) Human Over-expression Lysate
LY423729 100 µg

DBX2 (NM_001004329) Human Over-expression Lysate

Sign In for Pricing
View Details
SHARP1 (BHLHE41) Mouse Monoclonal Antibody [Clone ID: OTI3H3]
CF806407 100 µg

SHARP1 (BHLHE41) Mouse Monoclonal Antibody [Clone ID: OTI3H3]

Sign In for Pricing
View Details
Rat Amylase Alpha 2, Pancreatic (AMY2) ELISA Kit
RDR-AMY2-Ra-01 96 Tests

Rat Amylase Alpha 2, Pancreatic (AMY2) ELISA Kit

Sign In for Pricing
View Details
Rat Amylase Alpha 2, Pancreatic (AMY2) ELISA Kit
RDR-AMY2-Ra-02 48 Tests

Rat Amylase Alpha 2, Pancreatic (AMY2) ELISA Kit

Sign In for Pricing
View Details
Tungsten(VI) Oxide
TRC-T897260-25G 25 g

Tungsten(VI) Oxide

Sign In for Pricing
View Details