Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Lymphocyte antigen 6S (LY6S), Biotinylated

This Recombinant Human Lymphocyte antigen 6S (LY6S), Biotinylated spans the amino acid sequence from region 27-105. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Lymphocyte antigen 6S LY6S

UniProt

P0DTL4

Expression Region

27-105

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

LRCYRCLAVLEGASCSVVSCPFLDGVCVSQKVSVFGSKVRGENKLSLLSCQKDVGFPLLKLTSAVVDSQISCCKGDLCN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant MALT1 Antibody
RC-15673-01 50 μL

Recombinant MALT1 Antibody

Sign In for Pricing
View Details
Recombinant MALT1 Antibody
RC-15673-02 100 µL

Recombinant MALT1 Antibody

Sign In for Pricing
View Details
Recombinant MALT1 Antibody
RC-15673-03 1 mL

Recombinant MALT1 Antibody

Sign In for Pricing
View Details
Human Tumor Necrosis Factor Receptor Superfamily, Member 13B (TNFRSF13B) ELISA Kit
SL4512Hu-01 96 Tests

Human Tumor Necrosis Factor Receptor Superfamily, Member 13B (TNFRSF13B) ELISA Kit

Sign In for Pricing
View Details
Human Tumor Necrosis Factor Receptor Superfamily, Member 13B (TNFRSF13B) ELISA Kit
SL4512Hu-02 48 Tests

Human Tumor Necrosis Factor Receptor Superfamily, Member 13B (TNFRSF13B) ELISA Kit

Sign In for Pricing
View Details
KBTBD2 shRNA (h) Lentiviral Particles
sc-89549-V 200 µL

KBTBD2 shRNA (h) Lentiviral Particles

Sign In for Pricing
View Details