Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Speedy protein E15 (SPD15), Biotinylated

This Recombinant Human Speedy protein E15 (SPD15), Biotinylated spans the amino acid sequence from region 1-265. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Speedy protein E15 SPDYE15

UniProt

P0DUD4

Expression Region

1-265

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MGQILGKIMMSHQPQPQEERSPQRSTSGYPLQEVVDDEVLGPSAPGVDPSPPRRSLGWKRKRECLDESDDEPEKELAPEPEETWVAETLCGLKMKAKRRRVSLVLPEYYEAFNRLLEDPVIKRLLAWDKDLRVSDKYLLAMVIAYFSRAGLPSWQYQRIHFFLALYLANDMEEDDEAPKQNIFYFLYEETRSHIPLLSELWFQLCRYMNPRARKNCSQIALFRKYRFHFFCSMRCRAWVSLEELEEIQAYDPEHWVWARDRAHLS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Denibulin
TRC-D371770-100MG 100 mg

Denibulin

Sign In for Pricing
View Details
Calindol-13C,d2 Hydrochloride
TRC-C148702-1MG 1 mg

Calindol-13C,d2 Hydrochloride

Sign In for Pricing
View Details
COASY (NM_025233) Human Over-expression Lysate
LY403068 100 µg

COASY (NM_025233) Human Over-expression Lysate

Sign In for Pricing
View Details
PCB 105-13C12
TRC-P216632-2.5MG 2.5 mg

PCB 105-13C12

Sign In for Pricing
View Details
Homeo box C10 (HOXC10) Mouse Monoclonal Antibody [Clone ID: OTI1A9]
CF808929 100 µg

Homeo box C10 (HOXC10) Mouse Monoclonal Antibody [Clone ID: OTI1A9]

Sign In for Pricing
View Details
Recombinant Rabbit IgG [PSH04-42] - Isotype control
HA722127 100 µL

Recombinant Rabbit IgG [PSH04-42] - Isotype control

Sign In for Pricing
View Details