Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Speedy protein E15 (SPD15), Biotinylated

This Recombinant Human Speedy protein E15 (SPD15), Biotinylated spans the amino acid sequence from region 1-265. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Speedy protein E15 SPDYE15

UniProt

P0DUD4

Expression Region

1-265

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MGQILGKIMMSHQPQPQEERSPQRSTSGYPLQEVVDDEVLGPSAPGVDPSPPRRSLGWKRKRECLDESDDEPEKELAPEPEETWVAETLCGLKMKAKRRRVSLVLPEYYEAFNRLLEDPVIKRLLAWDKDLRVSDKYLLAMVIAYFSRAGLPSWQYQRIHFFLALYLANDMEEDDEAPKQNIFYFLYEETRSHIPLLSELWFQLCRYMNPRARKNCSQIALFRKYRFHFFCSMRCRAWVSLEELEEIQAYDPEHWVWARDRAHLS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Sections, Pancreas
CS517393 5x 5 µm

Frozen Tissue Sections, Pancreas

Sign In for Pricing
View Details
ZFAT (NM_001174158) Human Over-expression Lysate
LC433657 20 µg

ZFAT (NM_001174158) Human Over-expression Lysate

Sign In for Pricing
View Details
DDX51 Antibody
8C14656-AAT 50 µg

DDX51 Antibody

Sign In for Pricing
View Details
TIMP2 (Tissue Inhibitor of Metalloproteinase 2) (TIMP2/2044), 0.2mg/mL
BNUB2044-100 1x 100 µL

TIMP2 (Tissue Inhibitor of Metalloproteinase 2) (TIMP2/2044), 0.2mg/mL

Sign In for Pricing
View Details
Muscle Specific Actin (MSA/953), CF568 conjugate, 0.1mg/mL
BNC680953-100 1x 100 µL

Muscle Specific Actin (MSA/953), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Histone H3 (tri methyl K36) Recombinant Rabbit monoclonal Antibody
HA751539 100 µL

Histone H3 (tri methyl K36) Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details