Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Speedy protein E15 (SPD15), Biotinylated

This Recombinant Human Speedy protein E15 (SPD15), Biotinylated spans the amino acid sequence from region 1-265. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Speedy protein E15 SPDYE15

UniProt

P0DUD4

Expression Region

1-265

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MGQILGKIMMSHQPQPQEERSPQRSTSGYPLQEVVDDEVLGPSAPGVDPSPPRRSLGWKRKRECLDESDDEPEKELAPEPEETWVAETLCGLKMKAKRRRVSLVLPEYYEAFNRLLEDPVIKRLLAWDKDLRVSDKYLLAMVIAYFSRAGLPSWQYQRIHFFLALYLANDMEEDDEAPKQNIFYFLYEETRSHIPLLSELWFQLCRYMNPRARKNCSQIALFRKYRFHFFCSMRCRAWVSLEELEEIQAYDPEHWVWARDRAHLS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Vascular Endothelial Growth Factor Receptor 2 (FLK1/KDR) ELISA Kit
IHUVEGFR2KT 1 Each

Human Vascular Endothelial Growth Factor Receptor 2 (FLK1/KDR) ELISA Kit

Sign In for Pricing
View Details
Zfp566-set siRNA/shRNA/RNAi Lentivector (Rat)
51026096 4x 500 ng

Zfp566-set siRNA/shRNA/RNAi Lentivector (Rat)

Sign In for Pricing
View Details
β-defensin 12 Double Nickase Plasmid (m)
sc-429565-NIC 20 µg

β-defensin 12 Double Nickase Plasmid (m)

Sign In for Pricing
View Details
SCAP Rabbit Polyclonal Antibody (PerCP-Cy5.5)
orb2426624 100 µL

SCAP Rabbit Polyclonal Antibody (PerCP-Cy5.5)

Sign In for Pricing
View Details
Recombinant Mycobacterium Bovis Mb2876c Protein (aa 1-156)
VAng-Yyj3103-50gEcoli 50 µg (E. coli)

Recombinant Mycobacterium Bovis Mb2876c Protein (aa 1-156)

Sign In for Pricing
View Details
ATG4C Antibody
E034632 100 µg -100 µL

ATG4C Antibody

Sign In for Pricing
View Details