Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Histone H2B.N (H2BN1), Biotinylated

This Recombinant Human Histone H2B.N (H2BN1), Biotinylated spans the amino acid sequence from region 1-118. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Histone H2B.N; H2B.N; H2B.N variant histone 1; H2BN1

UniProt

P0DW85

Expression Region

1-118

Origin

Homo sapiens (Human)

Field of Research

Epigenetics & Chromatin

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MYFICLNDLRFPKNKTELYFPVKKKHEWANSATGKKRRWRKKRRKEAYFSYMGKILKQIHPDFSGRSWVLYALGALNAWQLEWVSLEAFRLSFYNHRRAITGREILGAVKQRSSQKSF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Dnajb12 Antibody - N-terminal region : Biotin (ARP37278_P050-Biotin)
ARP37278_P050-Biotin 100 µL

Dnajb12 Antibody - N-terminal region : Biotin (ARP37278_P050-Biotin)

Sign In for Pricing
View Details
Human JTB siRNA
abx902753-01 15 nmol

Human JTB siRNA

Sign In for Pricing
View Details
Human JTB siRNA
abx902753-02 30 nmol

Human JTB siRNA

Sign In for Pricing
View Details
PerCP/Fire™ 780 anti-mouse CD335 (NKp46)
GT04187 25 µg

PerCP/Fire™ 780 anti-mouse CD335 (NKp46)

Sign In for Pricing
View Details
OPCA04066-100UG - CASR Recombinant Protein (Human)
OPCA04066-100UG 100 µg

OPCA04066-100UG - CASR Recombinant Protein (Human)

Sign In for Pricing
View Details
Tus Antibody
orb834452 2 mg

Tus Antibody

Sign In for Pricing
View Details