Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Thymosin beta-15C (TB15C), Biotinylated

This Recombinant Human Thymosin beta-15C (TB15C), Biotinylated spans the amino acid sequence from region 2-45. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Thymosin beta-15C TMSB15C

UniProt

P0DX04

Expression Region

2-45

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

SDKPDLSEVEKFDRSKLKKTNTEEKNTLPSKETIQQEKECVQTS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ADORA2B Protein Vector (Mouse) (pPB-C-His)
PV152754 500 ng

ADORA2B Protein Vector (Mouse) (pPB-C-His)

Sign In for Pricing
View Details
Sodium Hydrogen Carbonate
3124886 1 Each

Sodium Hydrogen Carbonate

Sign In for Pricing
View Details
Monkey Tissue Inhibitors Of Metalloproteinase 3 (TIMP3) ELISA Kit
BSKA66405-01 48 Tests

Monkey Tissue Inhibitors Of Metalloproteinase 3 (TIMP3) ELISA Kit

Sign In for Pricing
View Details
Monkey Tissue Inhibitors Of Metalloproteinase 3 (TIMP3) ELISA Kit
BSKA66405-02 96 Tests

Monkey Tissue Inhibitors Of Metalloproteinase 3 (TIMP3) ELISA Kit

Sign In for Pricing
View Details
Human intercellular adhesion molecule 4, ICAM-4 ELISA Kit
MBS161713-01 48 Well

Human intercellular adhesion molecule 4, ICAM-4 ELISA Kit

Sign In for Pricing
View Details
Human intercellular adhesion molecule 4, ICAM-4 ELISA Kit
MBS161713-02 96 Well

Human intercellular adhesion molecule 4, ICAM-4 ELISA Kit

Sign In for Pricing
View Details