Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Protein FAM27E3 (F27E3), Biotinylated

This Recombinant Human Protein FAM27E3 (F27E3), Biotinylated spans the amino acid sequence from region 1-113. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Protein FAM27E3 FAM27E3

UniProt

Q08E93

Expression Region

1-113

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MGIFQLLRDRRISSRGPGLHTPKAEPRRRKGLTTGLMTQAERQKQAHQRQAAMRETALWCTGHIRPRTHTHTGTHTQTDRERERNTQRLRDRERRENGRHTHTYTHRHTHRVL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Bcat2 protein
orb603930-01 20 µg

Mouse Bcat2 protein

Sign In for Pricing
View Details
Mouse Bcat2 protein
orb603930-02 100 µg

Mouse Bcat2 protein

Sign In for Pricing
View Details
Mouse Bcat2 protein
orb603930-03 1 mg

Mouse Bcat2 protein

Sign In for Pricing
View Details
LACC1 siRNA (h)
sc-105147 10 µM

LACC1 siRNA (h)

Sign In for Pricing
View Details
AKAP4 Polyclonal Antibody
RD81919A-01 60 μL

AKAP4 Polyclonal Antibody

Sign In for Pricing
View Details
AKAP4 Polyclonal Antibody
RD81919A-02 120 μL

AKAP4 Polyclonal Antibody

Sign In for Pricing
View Details