Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Testis development-related protein 1 (TDRG1), Biotinylated

This Recombinant Human Testis development-related protein 1 (TDRG1), Biotinylated spans the amino acid sequence from region 1-100. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Testis development-related protein 1 TDRG1

UniProt

Q3Y452

Expression Region

1-100

Origin

Homo sapiens (Human)

Field of Research

Stem Cell & Developmental Biology

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MKRREAVCAHRHFLGTGKPPHPLGRSIPVEPCPGLPAFAEVDLLSLLVPIKISSTPPSGSRLDPQIASSAFPGLGSLGGQDSSGSLVQRASCELESPYEL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

S100A6 Protein Vector (Rat) (pPM-C-His)
PV303161 500 ng

S100A6 Protein Vector (Rat) (pPM-C-His)

Sign In for Pricing
View Details
Fetoprotein, Alpha, Human Cell Line Antigen, 95+% (AFP, Alpha1-fetoprotein, Alpha-fetoglobulin, Alpha-fetoprotein precursor, FETA, HPAFP)
F4100-22 1 mg

Fetoprotein, Alpha, Human Cell Line Antigen, 95+% (AFP, Alpha1-fetoprotein, Alpha-fetoglobulin, Alpha-fetoprotein precursor, FETA, HPAFP)

Sign In for Pricing
View Details
Texas Red 4’-Propargyl Sulfonamide 2’-Sulfate
TRC-T320210-1MG 1 mg

Texas Red 4’-Propargyl Sulfonamide 2’-Sulfate

Sign In for Pricing
View Details
BTG3 (NM_006806) Human Over-expression Lysate
LY416410 100 µg

BTG3 (NM_006806) Human Over-expression Lysate

Sign In for Pricing
View Details
Rat ferritin (FE) ELISA Kit
GA-E0604RT-01 48 Tests

Rat ferritin (FE) ELISA Kit

Sign In for Pricing
View Details
Rat ferritin (FE) ELISA Kit
GA-E0604RT-02 96 Tests

Rat ferritin (FE) ELISA Kit

Sign In for Pricing
View Details