Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Testis development-related protein 1 (TDRG1), Biotinylated

This Recombinant Human Testis development-related protein 1 (TDRG1), Biotinylated spans the amino acid sequence from region 1-100. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Testis development-related protein 1 TDRG1

UniProt

Q3Y452

Expression Region

1-100

Origin

Homo sapiens (Human)

Field of Research

Stem Cell & Developmental Biology

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MKRREAVCAHRHFLGTGKPPHPLGRSIPVEPCPGLPAFAEVDLLSLLVPIKISSTPPSGSRLDPQIASSAFPGLGSLGGQDSSGSLVQRASCELESPYEL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal Integrin alpha 6/CD49f Antibody (MP4F10) [DyLight 650]
FAB1350W 0.5 mL

Mouse Monoclonal Integrin alpha 6/CD49f Antibody (MP4F10) [DyLight 650]

Sign In for Pricing
View Details
Flag (DYKDDDDK) Epitope Tag (HRP) discontinued
F4524-72G-HRP 100 µL

Flag (DYKDDDDK) Epitope Tag (HRP) discontinued

Sign In for Pricing
View Details
XpressTM Human SIRPA Over-expressing Cell Line (293T)
ABC-X0194C 1 Vial

XpressTM Human SIRPA Over-expressing Cell Line (293T)

Sign In for Pricing
View Details
TCIRG1 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)
LV635527 1.0 µg DNA

TCIRG1 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
ARL1 Antibody - C-terminal region : HRP (ARP64039_P050-HRP)
ARP64039_P050-HRP 100 µL

ARL1 Antibody - C-terminal region : HRP (ARP64039_P050-HRP)

Sign In for Pricing
View Details
Mouse Monoclonal Laminin S/Laminin beta 2 Antibody (OTI3B4) [HRP]
NBP2-71114H 0.1 mL

Mouse Monoclonal Laminin S/Laminin beta 2 Antibody (OTI3B4) [HRP]

Sign In for Pricing
View Details