Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Testis development-related protein 1 (TDRG1), Biotinylated

This Recombinant Human Testis development-related protein 1 (TDRG1), Biotinylated spans the amino acid sequence from region 1-100. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Testis development-related protein 1 TDRG1

UniProt

Q3Y452

Expression Region

1-100

Origin

Homo sapiens (Human)

Field of Research

Stem Cell & Developmental Biology

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MKRREAVCAHRHFLGTGKPPHPLGRSIPVEPCPGLPAFAEVDLLSLLVPIKISSTPPSGSRLDPQIASSAFPGLGSLGGQDSSGSLVQRASCELESPYEL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HOXA13 Rabbit pAb
E2509822 100 µL

HOXA13 Rabbit pAb

Sign In for Pricing
View Details
Raf1 (PE) discontinued
R0495-02A-PE 100 µL

Raf1 (PE) discontinued

Sign In for Pricing
View Details
Purified Anti-Human CD122 Antibody[Mik-b1]
AN003590P-01 25 µg

Purified Anti-Human CD122 Antibody[Mik-b1]

Sign In for Pricing
View Details
Purified Anti-Human CD122 Antibody[Mik-b1]
AN003590P-02 100 µg

Purified Anti-Human CD122 Antibody[Mik-b1]

Sign In for Pricing
View Details
Purified Anti-Human CD122 Antibody[Mik-b1]
AN003590P-03 1 mg

Purified Anti-Human CD122 Antibody[Mik-b1]

Sign In for Pricing
View Details
Purified Anti-Human CD122 Antibody[Mik-b1]
AN003590P-04 5 mg

Purified Anti-Human CD122 Antibody[Mik-b1]

Sign In for Pricing
View Details