Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Protein FAM153A (F153A), Biotinylated

This Recombinant Human Protein FAM153A (F153A), Biotinylated spans the amino acid sequence from region 1-310. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Protein FAM153A; Renal carcinoma antigen NY-REN-7; FAM153A KIAA0752

UniProt

Q9UHL3

Expression Region

1-310

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MVDKDTERDIEMKRQLRRLRELHLYSTWKKYQEAMKTSLGVPQCERDEGSLGKPLCPPEILSETLPGSVKKRVCFPSEDHLEEFIAEHLPEASNQSLLTVAHADAGTQTNGDLEDLEEHGPGQTVSEEATEVHTMEGDPDTLAEFLIRDVLQELSSYNGEEEDPEEVKTSLGVPQRGDLEDLEEHVPGQTVSEEATGVHMMQVDPATLAKSDLEDLEEHVPEQTVSEEATGVHMMQVDPATLAKQLEDSTITGSHQQMSASPSSAPAEEATEKTKVEEEVKTRKPKKKTRKPSKKSRWNVLKCWDIFNIF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Paired Box Gene 6 (PAX6) ELISA Kit
RDR-PAX6-Hu-96Tests 96 Tests

Human Paired Box Gene 6 (PAX6) ELISA Kit

Sign In for Pricing
View Details
Recombinant Dictyostelium discoideum Tiger protein I3 (tgrI3), partial
MBS1286272 Inquire

Recombinant Dictyostelium discoideum Tiger protein I3 (tgrI3), partial

Sign In for Pricing
View Details
1-Boc-3-Hydroxypiperidine
408910-01 5 g

1-Boc-3-Hydroxypiperidine

Sign In for Pricing
View Details
1-Boc-3-Hydroxypiperidine
408910-02 25 g

1-Boc-3-Hydroxypiperidine

Sign In for Pricing
View Details
S100B Antibody
orb2640267 100 µg

S100B Antibody

Sign In for Pricing
View Details
Rat Claudin 5 (CLDN5) ELISA Kit
MBS458412-01 48 Tests

Rat Claudin 5 (CLDN5) ELISA Kit

Sign In for Pricing
View Details