Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Lens epithelial cell protein LEP503 (LENEP), Biotinylated

This Recombinant Human Lens epithelial cell protein LEP503 (LENEP), Biotinylated spans the amino acid sequence from region 1-61. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Lens epithelial cell protein LEP503 LENEP LEP503

UniProt

Q9Y5L5

Expression Region

1-61

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MQPRTQPLAQTLPFFLGGAPRDTGLRVPVIKMGTGWEGFQRTLKEVAYILLCCWCIKELLD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Reagecon Buffer Standard pH 7.00 at 20°C ISO 17034 Certified Reference Material
CRM1070 1 L

Reagecon Buffer Standard pH 7.00 at 20°C ISO 17034 Certified Reference Material

Sign In for Pricing
View Details
Dnaja1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)
K3723406 1.0 µg DNA

Dnaja1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details
RTP4 (h) -PR
sc-77909-PR 10 µM - 20 µL

RTP4 (h) -PR

Sign In for Pricing
View Details
Lentiviral mouse Fam57b shRNA (UAS) - Lentiviral mouse Fam57b shRNA (UAS, RFP) plasmid
GTR15193309 1 Vial

Lentiviral mouse Fam57b shRNA (UAS) - Lentiviral mouse Fam57b shRNA (UAS, RFP) plasmid

Sign In for Pricing
View Details
TRPC4 Protein Vector (Rat) (pPB-N-His)
PV313135 500 ng

TRPC4 Protein Vector (Rat) (pPB-N-His)

Sign In for Pricing
View Details
LAG3 Antibody
orb1312728-01 30 µL

LAG3 Antibody

Sign In for Pricing
View Details