Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Putative uncharacterized protein CCDC28A-AS1 (GVQW2), Biotinylated

This Recombinant Human Putative uncharacterized protein CCDC28A-AS1 (GVQW2), Biotinylated spans the amino acid sequence from region 1-108. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Putative uncharacterized protein CCDC28A-AS1; GVQW motif-containing protein 2; CCDC28A-AS1 GVQW2

UniProt

A0A096LPI5

Expression Region

1-108

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MQYPFRKLLRPSTESCCVAQARVQWCHLGSLQPPLPGFKQFSCHSLPSSWDYRWNLTLSPRLECSGAISAHCNLCLPDLSDSPASTSRVAGTTGAHHHAQEPVVIRKM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Cd160 shRNA (UAS) - Lentiviral mouse Cd160 shRNA (UAS) (100)
GTR15235338 1 Vial

Lentiviral mouse Cd160 shRNA (UAS) - Lentiviral mouse Cd160 shRNA (UAS) (100)

Sign In for Pricing
View Details
Rabbit anti-Saccharomyces cerevisiae (strain 204508/S288c)(Baker's yeast) YLR101C Polyclonal Antibody
MBS7190396 Inquire

Rabbit anti-Saccharomyces cerevisiae (strain 204508/S288c)(Baker's yeast) YLR101C Polyclonal Antibody

Sign In for Pricing
View Details
SLAM Family Member 6, Recombinant, Human, aa22-226, His-Tag, Myc-Tag
586356-01 20 µg

SLAM Family Member 6, Recombinant, Human, aa22-226, His-Tag, Myc-Tag

Sign In for Pricing
View Details
SLAM Family Member 6, Recombinant, Human, aa22-226, His-Tag, Myc-Tag
586356-02 100 µg

SLAM Family Member 6, Recombinant, Human, aa22-226, His-Tag, Myc-Tag

Sign In for Pricing
View Details
Rat Angiopoietin Like Protein 6 (ANGPTL6) ELISA Kit
DLR-ANGPTL6-Ra-48T 48 Tests

Rat Angiopoietin Like Protein 6 (ANGPTL6) ELISA Kit

Sign In for Pricing
View Details
Mouse c1q (c1q) ELISA Kit
YP-W24251-01 48 Tests

Mouse c1q (c1q) ELISA Kit

Sign In for Pricing
View Details