Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Putative uncharacterized protein CCDC28A-AS1 (GVQW2), Biotinylated

This Recombinant Human Putative uncharacterized protein CCDC28A-AS1 (GVQW2), Biotinylated spans the amino acid sequence from region 1-108. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Putative uncharacterized protein CCDC28A-AS1; GVQW motif-containing protein 2; CCDC28A-AS1 GVQW2

UniProt

A0A096LPI5

Expression Region

1-108

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MQYPFRKLLRPSTESCCVAQARVQWCHLGSLQPPLPGFKQFSCHSLPSSWDYRWNLTLSPRLECSGAISAHCNLCLPDLSDSPASTSRVAGTTGAHHHAQEPVVIRKM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TAF6 Antibody (N-term) Blocking Peptide
MBS9220931-01 0.5 mg

TAF6 Antibody (N-term) Blocking Peptide

Sign In for Pricing
View Details
TAF6 Antibody (N-term) Blocking Peptide
MBS9220931-02 5x 0.5 mg

TAF6 Antibody (N-term) Blocking Peptide

Sign In for Pricing
View Details
Recombinant IAV H7N9 Hemagglutinin / HA Protein (aa 1-524) [His] (A/Shanghai/1/2013) (HEK293 Cells)
VAng-Wyb7264-50g 50 µg

Recombinant IAV H7N9 Hemagglutinin / HA Protein (aa 1-524) [His] (A/Shanghai/1/2013) (HEK293 Cells)

Sign In for Pricing
View Details
Rabbit Polyclonal CXCR3 Antibody [DyLight 405]
NBP2-41250V 0.1 mL

Rabbit Polyclonal CXCR3 Antibody [DyLight 405]

Sign In for Pricing
View Details
Fads3 Mouse shRNA Lentiviral Particle (Locus ID 60527)
TL503434V 500 µL Each

Fads3 Mouse shRNA Lentiviral Particle (Locus ID 60527)

Sign In for Pricing
View Details
ANKRD10 Rabbit Polyclonal Antibody
TA370333 100 µL

ANKRD10 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details