Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Small integral membrane protein 10-like protein 3 (SGSN1), Biotinylated

This Recombinant Human Small integral membrane protein 10-like protein 3 (SGSN1), Biotinylated spans the amino acid sequence from region 1-68. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Small integral membrane protein 10-like protein 3; Salivary gland-specific protein SAGSIN1; SMIM10L3 SAGSIN1

UniProt

A0A0C4DGP1

Expression Region

1-68

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MAAALSGLAVRLSRSAAARSYGVFCKGLTRTLLIFFDLAWRLRINFPYLYIVASMMLNVRLQVHIEIH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CLEC4E (NM_014358) Human Over-expression Lysate
LH09131V 100 µg

CLEC4E (NM_014358) Human Over-expression Lysate

Sign In for Pricing
View Details
Rabbit Polyclonal CHM Antibody
NBP1-84954-25ul 25 µL

Rabbit Polyclonal CHM Antibody

Sign In for Pricing
View Details
Mouse Monoclonal Nesprin 2 Antibody (10H8) [PerCP]
NBP2-59945PCP 0.1 mL

Mouse Monoclonal Nesprin 2 Antibody (10H8) [PerCP]

Sign In for Pricing
View Details
Polyclonal Toe1 antibody - middle region
APR00707G 0.05mg

Polyclonal Toe1 antibody - middle region

Sign In for Pricing
View Details
UBE2C (Ubiquitin-conjugating Enzyme E2C, UBCH10, dJ447F3.2)
253202 100 µg

UBE2C (Ubiquitin-conjugating Enzyme E2C, UBCH10, dJ447F3.2)

Sign In for Pricing
View Details
ANKRD55 Human Gene Knockout Kit (CRISPR)
KN421211 1 Kit

ANKRD55 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details