Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Glycine-rich extracellular protein 1 (GREP1), Biotinylated

This Recombinant Human Glycine-rich extracellular protein 1 (GREP1), Biotinylated spans the amino acid sequence from region 23-536. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Glycine-rich extracellular protein 1; Long intergenic non-protein coding RNA 514; GREP1 LINC00514

UniProt

A0A0J9YXV3

Expression Region

23-536

Origin

Homo sapiens (Human)

Field of Research

Pharmacology & Drug Discovery

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GLPLLPPGLGKVYGPHSGLGAGYDGGVKPQKPGFVVRHGLGTQPDTEGGMKPQNLGFRTFAGAAAQPGYGNGLGAAAFPVAGAQSGPAAQNGFGPGFGGGGKPQKPGPTTQNGYRPGYVGAVKPQKPGFQYRIGLGAQPGFRGDMKAQEPGLGNGNGLSAQPVLTAQNRFGFGAGLGGNVKPLKPGYGKRLRAGAFPGAGTQPEYGHGNGPGVQPGLGAGMKPQMPGLGAPNGYGPGRGRAGVPGGPERRPWVPHLLPFSSPGYLGVMKAQKPGPLAQNGYRAGAGEGMKPQKPGLRGTLKPQKSGHGHENGPWPGPCNARVAPMLLPRLPTPGVPSDKEGGWGLKSQPPSAVQNGKLPAPMPAIQWGLKPQKAGHQPPNGYGPGAEPGFNGGLEPQKIGLGYGNGVLGARVFPEAHPQPGFHGANGFRNRDGVEALVYPKAAALAPEGNGQAGVLWNSRWPTLQAWGAGLKPGYQAGDEYAEARSQPGGPDVKRGSNGQLGNGYGGRCPLGKC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CEP70 CRISPR Knock Out 293T Cell Line (Human)
15914141 1x 10^6 Cells / 1.0 mL

CEP70 CRISPR Knock Out 293T Cell Line (Human)

Sign In for Pricing
View Details
5530400C23Rik Lentiviral Activation Particles (m)
sc-433171-LAC 200 µL

5530400C23Rik Lentiviral Activation Particles (m)

Sign In for Pricing
View Details
Lentiviral human CLDN1 sgRNA gene knockout kit - Lentiviral human CLDN1 sgRNA gene knockout kit (100)
GTR15367885 1 Vial

Lentiviral human CLDN1 sgRNA gene knockout kit - Lentiviral human CLDN1 sgRNA gene knockout kit (100)

Sign In for Pricing
View Details
Rabbit Monoclonal IL-23 Antibody (207) [Alexa Fluor 405]
NBP3-26067AF405 0.1 mL

Rabbit Monoclonal IL-23 Antibody (207) [Alexa Fluor 405]

Sign In for Pricing
View Details
Porcine WD repeat containing protein 24 (WDR24) ELISA Kit
GTR10341998 96 Well

Porcine WD repeat containing protein 24 (WDR24) ELISA Kit

Sign In for Pricing
View Details
Rabbit Polyclonal LIV-1/Zip6 Antibody [Biotin]
NBP1-76503B 0.1 mL

Rabbit Polyclonal LIV-1/Zip6 Antibody [Biotin]

Sign In for Pricing
View Details