Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human LBH domain-containing protein 2 (LBHD2), Biotinylated

This Recombinant Human LBH domain-containing protein 2 (LBHD2), Biotinylated spans the amino acid sequence from region 1-108. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

LBH domain-containing protein 2 LBHD2

UniProt

A0A0U1RRK4

Expression Region

1-108

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MSTPRPAPPQPGAAEGAGGPEGKAVAGAWEKGPRLGQRLPSIVVEPSEADPVESGELRWPLESAQRGPSQSRAAAAPSPSLPGEPGKAADNAGSECACSEDPAAPARG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal CD4 Antibody (296712) [Allophycocyanin/Cy7]
FAB2410APCCY7 0.1 mL

Mouse Monoclonal CD4 Antibody (296712) [Allophycocyanin/Cy7]

Sign In for Pricing
View Details
Lentiviral human PCSK1 shRNA (UAS) - Lentiviral human PCSK1 shRNA (UAS) plasmid
GTR15323578 1 Vial

Lentiviral human PCSK1 shRNA (UAS) - Lentiviral human PCSK1 shRNA (UAS) plasmid

Sign In for Pricing
View Details
Cow Platelet-activating factor acetylhydrolase IB subunit gamma (PAFAH1B3) ELISA Kit
abx517382 96 Tests

Cow Platelet-activating factor acetylhydrolase IB subunit gamma (PAFAH1B3) ELISA Kit

Sign In for Pricing
View Details
Rabbit Polyclonal PFDN5 Antibody [Alexa Fluor 488]
NBP2-97061AF488 0.1 mL

Rabbit Polyclonal PFDN5 Antibody [Alexa Fluor 488]

Sign In for Pricing
View Details
Human TOX2 qPCR Primer Pair
QH56937S 200 Tests

Human TOX2 qPCR Primer Pair

Sign In for Pricing
View Details
Recombinant Vitamin D3 Receptor Antibody
RC-15563-01 50 μL

Recombinant Vitamin D3 Receptor Antibody

Sign In for Pricing
View Details