Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Protein FAM236D (F236D), Biotinylated

This Recombinant Human Protein FAM236D (F236D), Biotinylated spans the amino acid sequence from region 1-79. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Protein FAM236D FAM236D

UniProt

A0A1B0GTK5

Expression Region

1-79

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MIFTPFLPPADLSVFQNVKGPQKDPEELVAVSDTAEDPSSGTGLPREPALLRGSWRSRFQRALACFIKCFRGGYRALGI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

E-cadherin Polyclonal Antibody
RA20721-01 50 µL

E-cadherin Polyclonal Antibody

Sign In for Pricing
View Details
E-cadherin Polyclonal Antibody
RA20721-02 100 µL

E-cadherin Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Mycobacterium Tuberculosis gltX Protein (aa 1-490)
VAng-Yyj0467-50gEcoli 50 µg (E. coli)

Recombinant Mycobacterium Tuberculosis gltX Protein (aa 1-490)

Sign In for Pricing
View Details
8-Arm-PEG-CHO (MW 5000)
HY-W1123946E 1 Each

8-Arm-PEG-CHO (MW 5000)

Sign In for Pricing
View Details
PARVG 3'UTR Luciferase Stable Cell Line
TU017426 1.0 mL

PARVG 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
MUC5A Antibody
E19-9639-1 50 µg - 50 µL

MUC5A Antibody

Sign In for Pricing
View Details