Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Uncharacterized protein CXorf51A (CX05A), Biotinylated

This Recombinant Human Uncharacterized protein CXorf51A (CX05A), Biotinylated spans the amino acid sequence from region 1-108. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Uncharacterized protein CXorf51A CXorf51A CXorf51

UniProt

A0A1B0GTR3

Expression Region

1-108

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MAKVTSEPQKPNEDVDEQTPSTSSTKGRKKGKTPRQRRSRSGVKGLKTTRKAKRPLRGSSSQKAGETNTPAGKPKKARGPILRGRYHRLKEKMKKEEADKEQSETSVL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TRAPPC3 Human Gene Knockout Kit (CRISPR)
KN400602 1 Kit

TRAPPC3 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
ATG4B (NM_013325) Human Over-expression Lysate
LY429376 100 µg

ATG4B (NM_013325) Human Over-expression Lysate

Sign In for Pricing
View Details
AM 404
TRC-A575810-250MG 250 mg

AM 404

Sign In for Pricing
View Details
D16H22S680E (BC005445) Mouse Tagged ORF Clone
MG201075 10 µg

D16H22S680E (BC005445) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
OR10AG1 Human Gene Knockout Kit (CRISPR)
KN415852 1 Kit

OR10AG1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
BHLHB3 Antibody
8C11661-AAT 50 µg

BHLHB3 Antibody

Sign In for Pricing
View Details