Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Small proline-rich protein 5 (SPRR5), Biotinylated

This Recombinant Human Small proline-rich protein 5 (SPRR5), Biotinylated spans the amino acid sequence from region 1-108. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Small proline-rich protein 5 SPRR5

UniProt

A0A1B0GTR4

Expression Region

1-108

Origin

Homo sapiens (Human)

Field of Research

Pharmacology & Drug Discovery

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MSQQKQKQCAPPQQCCPPPQQRCPPPQQCCPPPQQCCPPPQQCCPPPQQCCPPPQQCCPPPQQCCPPPQQYCPPPQQTKQPCQPPPKCQEPCAPKCPPPQQCQTSKQK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

4,7-Dibromobenzo[c]-1,2,5-thiadiazole
sc-238994 1 g

4,7-Dibromobenzo[c]-1,2,5-thiadiazole

Sign In for Pricing
View Details
Lentiviral human HMGN2 sgRNA gene knockout kit - Lentiviral human HMGN2 sgRNA gene knockout kit (100)
GTR15397747 1 Vial

Lentiviral human HMGN2 sgRNA gene knockout kit - Lentiviral human HMGN2 sgRNA gene knockout kit (100)

Sign In for Pricing
View Details
Sugammadex sodium 50mg
A15989-50 50 mg

Sugammadex sodium 50mg

Sign In for Pricing
View Details
Rabbit Polyclonal (IgG) to Human SLC5A3 / SMIT2
MBS247736-01 0.05 mL

Rabbit Polyclonal (IgG) to Human SLC5A3 / SMIT2

Sign In for Pricing
View Details
Rabbit Polyclonal (IgG) to Human SLC5A3 / SMIT2
MBS247736-02 5x 0.05 mL

Rabbit Polyclonal (IgG) to Human SLC5A3 / SMIT2

Sign In for Pricing
View Details
Ran Double Nickase Plasmid (h)
sc-417223-NIC 20 µg

Ran Double Nickase Plasmid (h)

Sign In for Pricing
View Details