Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Testis-expressed protein 53 (TEX53), Biotinylated

This Recombinant Human Testis-expressed protein 53 (TEX53), Biotinylated spans the amino acid sequence from region 1-70. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Testis-expressed protein 53 TEX53

UniProt

A0A1B0GU33

Expression Region

1-70

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MGSKIFCCCRKTSEGSSTTVGFHNPRMFEQHHPRSFNLNTNSLHSAVPKRHPRLPYDNRMMLKACILRRP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

OAZ1 Rabbit Polyclonal Antibody (PerCP)
orb2504559 100 µL

OAZ1 Rabbit Polyclonal Antibody (PerCP)

Sign In for Pricing
View Details
Anti-HOXD8 Polyclonal Antibody
TMAB-07263-01 50 μL

Anti-HOXD8 Polyclonal Antibody

Sign In for Pricing
View Details
Anti-HOXD8 Polyclonal Antibody
TMAB-07263-02 100 µL

Anti-HOXD8 Polyclonal Antibody

Sign In for Pricing
View Details
Anti-HOXD8 Polyclonal Antibody
TMAB-07263-03 200 µL

Anti-HOXD8 Polyclonal Antibody

Sign In for Pricing
View Details
Orosomucoid 2 (ORM2) (NM_000608) Human Over-expression Lysate
LS005005 100 µg

Orosomucoid 2 (ORM2) (NM_000608) Human Over-expression Lysate

Sign In for Pricing
View Details
CD73 monoclonal antibody
MB65802-01 50 µL

CD73 monoclonal antibody

Sign In for Pricing
View Details