Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Testis-expressed protein 53 (TEX53), Biotinylated

This Recombinant Human Testis-expressed protein 53 (TEX53), Biotinylated spans the amino acid sequence from region 1-70. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Testis-expressed protein 53 TEX53

UniProt

A0A1B0GU33

Expression Region

1-70

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MGSKIFCCCRKTSEGSSTTVGFHNPRMFEQHHPRSFNLNTNSLHSAVPKRHPRLPYDNRMMLKACILRRP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LGALS16 Human Gene Knockout Kit (CRISPR)
KN430982 1 Kit

LGALS16 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Nepafenac 500mg
A10636-500 500 mg

Nepafenac 500mg

Sign In for Pricing
View Details
Anti-MUC3A/B Antibody Picoband® (Dylight488 Conjugate)
A08332-1-Dylight488 100 µg

Anti-MUC3A/B Antibody Picoband® (Dylight488 Conjugate)

Sign In for Pricing
View Details
PRAMEF18 (NM_001099850) Human Tagged ORF Clone Lentiviral Particle
RC218336L4V 200 µL

PRAMEF18 (NM_001099850) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Recombinant Sordaria macrospora Formation of crista junctions protein 1 (FCJ1)
MBS7014694-01 0.02 mg

Recombinant Sordaria macrospora Formation of crista junctions protein 1 (FCJ1)

Sign In for Pricing
View Details
Recombinant Sordaria macrospora Formation of crista junctions protein 1 (FCJ1)
MBS7014694-02 0.1 mg

Recombinant Sordaria macrospora Formation of crista junctions protein 1 (FCJ1)

Sign In for Pricing
View Details