Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Uncharacterized protein CFAP97D2 (C97D2), Biotinylated

This Recombinant Human Uncharacterized protein CFAP97D2 (C97D2), Biotinylated spans the amino acid sequence from region 1-98. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Uncharacterized protein CFAP97D2; CFAP97 domain-containing protein 2; CFAP97D2

UniProt

A0A1B0GU71

Expression Region

1-98

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MHGAPRLTFPCASEYLWHAREKAYQDHRRKVQSAQPLVDTRAPLTFRHLHLKLKRLKLEEERLSVIERDNRLLLEKVASVMRTRGQTDSKNNSKHRRK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Polyclonal Antibody to Superoxide Dismutase 1 (SOD1)
TRV-0058611-01 20 µL

Polyclonal Antibody to Superoxide Dismutase 1 (SOD1)

Sign In for Pricing
View Details
Polyclonal Antibody to Superoxide Dismutase 1 (SOD1)
TRV-0058611-02 100 µL

Polyclonal Antibody to Superoxide Dismutase 1 (SOD1)

Sign In for Pricing
View Details
Polyclonal Antibody to Superoxide Dismutase 1 (SOD1)
TRV-0058611-03 200 µL

Polyclonal Antibody to Superoxide Dismutase 1 (SOD1)

Sign In for Pricing
View Details
Polyclonal Antibody to Superoxide Dismutase 1 (SOD1)
TRV-0058611-04 1 mL

Polyclonal Antibody to Superoxide Dismutase 1 (SOD1)

Sign In for Pricing
View Details
Neutrophil Activating Protein 3 (NAP3, GRO1, CXCL1, GROa, GRO-A, MGSA-A, NAP3, SCYB1, Chemokine C-X-C-Motif Ligand 1, Melanoma Growth Stimulating Activity Alpha, Fibroblast Secretory Protein)
141647 200 µL

Neutrophil Activating Protein 3 (NAP3, GRO1, CXCL1, GROa, GRO-A, MGSA-A, NAP3, SCYB1, Chemokine C-X-C-Motif Ligand 1, Melanoma Growth Stimulating Activity Alpha, Fibroblast Secretory Protein)

Sign In for Pricing
View Details
Phospho-4E-BP1 (T70) Polyclonal Antibody
JOT-PHS01077-01 20 µL

Phospho-4E-BP1 (T70) Polyclonal Antibody

Sign In for Pricing
View Details