Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Small integral membrane protein 32 (SIM32), partial, Biotinylated

This Recombinant Human Small integral membrane protein 32 (SIM32), partial, Biotinylated spans the amino acid sequence from region 1-54. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Small integral membrane protein 32 SMIM32

UniProt

A0A1B0GUA5

Expression Region

1-54

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MYGDIFNATGGPEAAVGSALAPGATVKAEGALPLELATARGMRDGAATKPDLPT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human ZFP14 activation kit by CRISPRa
GA111676 1 Kit

Human ZFP14 activation kit by CRISPRa

Sign In for Pricing
View Details
Human Serine/Threonine Kinase 11 (STK11) ELISA Kit
RDR-STK11-Hu-01 96 Tests

Human Serine/Threonine Kinase 11 (STK11) ELISA Kit

Sign In for Pricing
View Details
Human Serine/Threonine Kinase 11 (STK11) ELISA Kit
RDR-STK11-Hu-02 48 Tests

Human Serine/Threonine Kinase 11 (STK11) ELISA Kit

Sign In for Pricing
View Details
Endothelin B Receptor (EDNRB) (NM_001122659) Human Over-expression Lysate
LC426542 20 µg

Endothelin B Receptor (EDNRB) (NM_001122659) Human Over-expression Lysate

Sign In for Pricing
View Details
Frozen Tissue Sections, Liver
CS622158 5x 5 µm

Frozen Tissue Sections, Liver

Sign In for Pricing
View Details
Lactoylglutathione Lyase (CPTC-GLO1-1), CF740 conjugate, 0.1mg/mL
BNC742258-100 1x 100 µL

Lactoylglutathione Lyase (CPTC-GLO1-1), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details